SH2D1B monoclonal antibody (M04), clone 2B4

Product Sizes

100 ug

£333.00

H00117157-M04-100UG

About this Product

SKU:: H00117157-M04
Application:: ELISA, Immunoprecipitation
translate.label.attr.clone:: 2B4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SH2D1B.
Host:: Mouse
Immunogen:: SH2D1B (NP_444512.2, 54 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: RIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket