MIA2 monoclonal antibody (M09), clone 2B9

Product Sizes

100 ug

£333.00

H00117153-M09-100UG

About this Product

SKU:: H00117153-M09
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2B9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant MIA2.
Host:: Mouse
Immunogen:: MIA2 (NP_473365.3, 448 a.a. ~ 553 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: TDESDTIPYLKKFLYNFDNPWNFQNIPKETELPFPKQILDQNNVIENEETGEFSIDNYPTDNTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket