OLIG1 monoclonal antibody (M05), clone 3B3

Product Sizes

100 ug

£333.00

H00116448-M05-100UG

About this Product

SKU:: H00116448-M05
Application:: ELISA, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 3B3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant OLIG1.
Host:: Mouse
Immunogen:: OLIG1 (NP_620450.1, 80 a.a. ~ 159 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket