OSBPL6 monoclonal antibody (M01A), clone 1C8
Product Sizes
200 ul
£333.00
H00114880-M01A-200UL
About this Product
- SKU:
- H00114880-M01A
- Application:
- ELISA
- translate.label.attr.clone:
- 1C8
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant OSBPL6.
- Host:
- Mouse
- Immunogen:
- OSBPL6 (NP_665682.1, 344 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG1, kappa
- Reactivities:
- Human
- Sequence:
- RLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNSIAIEKEKLKQMVSEQDHSKGHSTQMARLRQSLSQALNQNAELRS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00114880-M01A
