EPSTI1 monoclonal antibody (M02), clone 3G7

Product Sizes

50 ug

£333.00

H00094240-M02-50UG

About this Product

SKU:: H00094240-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3G7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant EPSTI1.
Host:: Mouse
Immunogen:: EPSTI1 (NP_001002264, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNRA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket