FOXQ1 monoclonal antibody (M10C), clone 2G6

Product Sizes

200 ul

£333.00

H00094234-M10C-200UL

About this Product

SKU:: H00094234-M10C
Additional Names:: CXGrade
Application:: ELISA
translate.label.attr.clone:: 2G6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant FOXQ1. This product is belong to Cell Culture Grade Antibody (CX Grade).
Host:: Mouse
Immunogen:: FOXQ1 (NP_150285, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket