FOXQ1 monoclonal antibody (M09J), clone 2E2
Product Sizes
100 ug
£494.00
H00094234-M09J-100UG
About this Product
- SKU:
- H00094234-M09J
- Additional Names:
- CXGrade
- Application:
- ELISA
- translate.label.attr.clone:
- 200
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant FOXQ1. This product is belong to Cell Culture Grade Antibody (CX Grade).
- Host:
- Mouse
- Immunogen:
- FOXQ1 (NP_150285, 110 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG2b, kappa
- Reactivities:
- Human
- Sequence:
- RSKPYTRRPKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00094234-M09J
