FTMT monoclonal antibody (M05), clone 6G3

Product Sizes

100 ug

£333.00

H00094033-M05-100UG

About this Product

SKU:: H00094033-M05
Application:: ELISA, Western Blot
translate.label.attr.clone:: 6G3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant FTMT.
Host:: Mouse
Immunogen:: FTMT (NP_803431.1, 143 a.a. ~ 242 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: QDIKKPEQDDWESGLHAMECALLLEKNVNQSLLELHALASDKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket