PTPN5 monoclonal antibody (M03), clone 2H5

Product Sizes

100 ug

£333.00

H00084867-M03-100UG

About this Product

SKU:: H00084867-M03
Application:: ELISA, Immunoprecipitation
translate.label.attr.clone:: 2H5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PTPN5.
Host:: Mouse
Immunogen:: PTPN5 (NP_116170, 388 a.a. ~ 486 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: WQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket