C1orf57 monoclonal antibody (M04), clone 2C3

Product Sizes

100 ug

£333.00

H00084284-M04-100UG

About this Product

SKU:: H00084284-M04
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2C3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant C1orf57.
Host:: Mouse
Immunogen:: C1orf57 (NP_115700, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: LALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket