CALN1 monoclonal antibody (M29), clone 2G5

Product Sizes

100 ug

£333.00

H00083698-M29-100UG

About this Product

SKU:: H00083698-M29
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2G5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CALN1.
Host:: Mouse
Immunogen:: CALN1 (AAH20200, 36 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: EELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLV
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket