TSGA10 monoclonal antibody (M08), clone 6E8

Product Sizes

100 ug

£333.00

H00080705-M08-100UG

About this Product

SKU:: H00080705-M08
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 6E8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant TSGA10.
Host:: Mouse
Immunogen:: TSGA10 (NP_079520, 599 a.a. ~ 698 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: LCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHHRSPDRGLDRSLEENLCYRDF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket