GEMIN7 monoclonal antibody (M09), clone 4H6
Product Sizes
100 ug
£333.00
H00079760-M09-100UG
About this Product
- SKU:
- H00079760-M09
- Application:
- ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
- translate.label.attr.clone:
- 4H6
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a partial recombinant GEMIN7.
- Host:
- Mouse
- Immunogen:
- GEMIN7 (NP_078983.1, 43 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG2a, kappa
- Reactivities:
- Human
- Sequence:
- ECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00079760-M09
