IRX3 monoclonal antibody (M05), clone 1D7

Product Sizes

100 ug

£333.00

H00079191-M05-100UG

About this Product

SKU:: H00079191-M05
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 1D7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant IRX3.
Host:: Mouse
Immunogen:: IRX3 (NP_077312, 182 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human, Mouse, Rat
Sequence:: RRRLKKENKMTWAPRSRTDEEGNAYGSEREEEDEEEDEEDCKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDLGLGPI
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket