ALG12 monoclonal antibody (M06), clone 5E3

Product Sizes

100 ug

£333.00

H00079087-M06-100UG

About this Product

SKU:: H00079087-M06
Application:: ELISA, Western Blot
translate.label.attr.clone:: 5E3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ALG12.
Host:: Mouse
Immunogen:: ALG12 (NP_077010, 369 a.a. ~ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human, Rat
Sequence:: NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket