BOLL monoclonal antibody (M39), clone 2G4

Product Sizes

100 ug

£333.00

H00066037-M39-100UG

About this Product

SKU:: H00066037-M39
Application:: ELISA, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 2G4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant BOLL.
Host:: Mouse
Immunogen:: BOLL (NP_149019, 80 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: FETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIY
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket