ACBD3 monoclonal antibody (M01), clone 2G2

Product Sizes

100 ug

£333.00

H00064746-M01-100UG

About this Product

SKU:: H00064746-M01
Application:: ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
translate.label.attr.clone:: 2G2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ACBD3.
Host:: Mouse
Immunogen:: ACBD3 (NP_073572, 73 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human, Mouse, Rat
Sequence:: RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket