NEUROG2 monoclonal antibody (M12), clone 1D2

Product Sizes

100 ug

£333.00

H00063973-M12-100UG

About this Product

SKU:: H00063973-M12
Application:: ELISA
translate.label.attr.clone:: 1D2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant NEUROG2.
Host:: Mouse
Immunogen:: NEUROG2 (NP_076924, 74 a.a. ~ 175 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: CRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCG
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket