CIDEC monoclonal antibody (M07), clone 2E2

Product Sizes

100 ug

£333.00

H00063924-M07-100UG

About this Product

SKU:: H00063924-M07
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2E2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CIDEC.
Host:: Mouse
Immunogen:: CIDEC (NP_071377.2, 53 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human, Mouse
Sequence:: SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket