TNRC6C monoclonal antibody (M08), clone 3G11

Product Sizes

100 ug

£333.00

H00057690-M08-100UG

About this Product

SKU:: H00057690-M08
Application:: ELISA, Immunofluorescence
translate.label.attr.clone:: 3G11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant TNRC6C.
Host:: Mouse
Immunogen:: TNRC6C (NP_061869, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: TDGPNNTNPMNSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGSSVSQVSGGSAEGISNSVWGLSPGNPATGNSNSGFSQGNGDTVNSALSAK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket