AVEN monoclonal antibody (M08), clone 2B10

Product Sizes

100 ug

£333.00

H00057099-M08-100UG

About this Product

SKU:: H00057099-M08
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2B10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant AVEN.
Host:: Mouse
Immunogen:: AVEN (NP_065104.1, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human, Mouse, Rat
Sequence:: APRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket