CIAPIN1 monoclonal antibody (M01), clone 5G8

Product Sizes

100 ug

£333.00

H00057019-M01-100UG

About this Product

SKU:: H00057019-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 5G8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CIAPIN1.
Host:: Mouse
Immunogen:: CIAPIN1 (NP_064709, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, lambda
Reactivities:: Human, Mouse, Rat
Sequence:: DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket