RETN monoclonal antibody (M23), clone 5E8

Product Sizes

100 ug

£333.00

H00056729-M23-100UG

About this Product

SKU:: H00056729-M23
Application:: ELISA, Western Blot
translate.label.attr.clone:: 5E8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant RETN.
Host:: Mouse
Immunogen:: RETN (NP_065148, 20 a.a. ~ 106 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: TLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRV*
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket