PCDHGC5 monoclonal antibody (M08), clone 3A6

Product Sizes

100 ug

£333.00

H00056097-M08-100UG

About this Product

SKU:: H00056097-M08
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3A6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PCDHGC5.
Host:: Mouse
Immunogen:: PCDHGC5 (NP_061752, 467 a.a. ~ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: RPPGSLLCTVAASDPDTGDNARLTYSIVGNQVQGAPASSFVYVNPEDGRIFAQRTFDYELLQMLQIVVGVRDSGSPPLHANTSLHVFVLDENDNAPAVLHPRPDWEHSA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket