APOB48R monoclonal antibody (M03), clone 2D7

Product Sizes

100 ug

£333.00

H00055911-M03-100UG

About this Product

SKU:: H00055911-M03
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 2D7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant APOB48R.
Host:: Mouse
Immunogen:: APOB48R (NP_061160, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: RGSQNEGAGRLRGPGDDRRHEVGSSAVEQTWGWGDGSSHGSQAERQDSGAGETAKAARCQEPSAHLEARKKSKAGSGACQDRSGQAQERQESHEQEVNRE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket