DCP1A monoclonal antibody (M06), clone 3G4

Product Sizes

50 ug

£333.00

H00055802-M06-50UG

About this Product

SKU:: H00055802-M06
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 3G4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant DCP1A.
Host:: Mouse
Immunogen:: DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket