DSU monoclonal antibody (M01), clone 8F9-1B2

Product Sizes

100 ug

£333.00

H00055686-M01-100UG

About this Product

SKU:: H00055686-M01
Application:: ELISA, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 8F9-1B2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant DSU.
Host:: Mouse
Immunogen:: DSU (AAH32747, 1 a.a. ~ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket