PPP1R9A monoclonal antibody (M01), clone 6A10

Product Sizes

100 ug

£333.00

H00055607-M01-100UG

About this Product

SKU:: H00055607-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 6A10
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PPP1R9A.
Host:: Mouse
Immunogen:: PPP1R9A (XP_371933, 1090 a.a. ~ 1188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human, Rat
Sequence:: PCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMI
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket