RPRD1A monoclonal antibody (M01), clone 1B8

Product Sizes

100 ug

£333.00

H00055197-M01-100UG

About this Product

SKU:: H00055197-M01
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 1B8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant RPRD1A.
Host:: Mouse
Immunogen:: RPRD1A (NP_060640, 76 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human, Mouse, Rat
Sequence:: EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket