APTX monoclonal antibody (M02), clone 2H6

Product Sizes

100 ug

£333.00

H00054840-M02-100UG

About this Product

SKU:: H00054840-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2H6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant APTX.
Host:: Mouse
Immunogen:: APTX (NP_778241.1, 69 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, lambda
Reactivities:: Human
Sequence:: KLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHW
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket