HES2 monoclonal antibody (M06), clone 2F4

Product Sizes

100 ug

£333.00

H00054626-M06-100UG

About this Product

SKU:: H00054626-M06
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2F4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant HES2.
Host:: Mouse
Immunogen:: HES2 (NP_061962, 41 a.a. ~ 114 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: LPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSAR
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket