ZDHHC13 monoclonal antibody (M01), clone 2A4

Product Sizes

100 ug

£333.00

H00054503-M01-100UG

About this Product

SKU:: H00054503-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2A4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ZDHHC13.
Host:: Mouse
Immunogen:: ZDHHC13 (NP_061901.2, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: NGQTPLMLSAHKVIGPEPTGFLLKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVDKLLEAGSSLDIQNVKGETPLDMALQNKNQLIIHMLKTEAKMRANQK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket