DCUN1D1 monoclonal antibody (M01), clone 3D7

Product Sizes

100 ug

£333.00

H00054165-M01-100UG

About this Product

SKU:: H00054165-M01
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 3D7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant DCUN1D1.
Host:: Mouse
Immunogen:: DCUN1D1 (NP_065691, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human, Mouse, Rat
Sequence:: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket