CSNK1G1 monoclonal antibody (M01), clone 3D1

Product Sizes

100 ug

£333.00

H00053944-M01-100UG

About this Product

SKU:: H00053944-M01
Application:: ELISA, IHC-Paraffin, Western Blot
translate.label.attr.clone:: 3D1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CSNK1G1.
Host:: Mouse
Immunogen:: CSNK1G1 (AAH17236, 293 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG3, kappa
Reactivities:: Human
Sequence:: KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket