GHRL monoclonal antibody (M10), clone 2C5

Product Sizes

100 ug

£333.00

H00051738-M10-100UG

About this Product

SKU:: H00051738-M10
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2C5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant GHRL.
Host:: Mouse
Immunogen:: GHRL (AAH25791.1, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket