ZMYND10 monoclonal antibody (M24), clone 3D11

Product Sizes

100 ug

£333.00

H00051364-M24-100UG

About this Product

SKU:: H00051364-M24
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3D11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ZMYND10.
Host:: Mouse
Immunogen:: ZMYND10 (NP_056980.2, 341 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: LERENRGKWQAIAKHQLQHVFSPSEQDLWLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket