ERAF monoclonal antibody (M32), clone 2E4

Product Sizes

100 ug

£333.00

H00051327-M32-100UG

About this Product

SKU:: H00051327-M32
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2E4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant ERAF.
Host:: Mouse
Immunogen:: ERAF (NP_057717.1, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket