IRAK4 monoclonal antibody (M07), clone 3C5

Product Sizes

100 ug

£333.00

H00051135-M07-100UG

About this Product

SKU:: H00051135-M07
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3C5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant IRAK4.
Host:: Mouse
Immunogen:: IRAK4 (NP_057207, 255 a.a. ~ 351 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: GDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGT
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket