GMNN monoclonal antibody (M01), clone 1A8

Product Sizes

100 ug

£333.00

H00051053-M01-100UG

About this Product

SKU:: H00051053-M01
Application:: ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
translate.label.attr.clone:: 1A8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant GMNN.
Host:: Mouse
Immunogen:: GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket