IL20 monoclonal antibody (M01), clone 2H8

Product Sizes

100 ug

£333.00

H00050604-M01-100UG

About this Product

SKU:: H00050604-M01
Application:: ELISA, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 2H8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant IL20.
Host:: Mouse
Immunogen:: IL20 (NP_061194, 67 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: RTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket