PIK3R4 monoclonal antibody (M04), clone 1H7

Product Sizes

100 ug

£333.00

H00030849-M04-100UG

About this Product

SKU:: H00030849-M04
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1H7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
Host:: Mouse
Immunogen:: PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human, Rat
Sequence:: AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket