GLTSCR2 monoclonal antibody (M03), clone 5A8

Product Sizes

100 ug

£333.00

H00029997-M03-100UG

About this Product

SKU:: H00029997-M03
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 5A8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant GLTSCR2.
Host:: Mouse
Immunogen:: GLTSCR2 (NP_056525, 402 a.a. ~ 478 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: KPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket