POMT2 monoclonal antibody (M01), clone 1D9

Product Sizes

100 ug

£333.00

H00029954-M01-100UG

About this Product

SKU:: H00029954-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1d9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant POMT2.
Host:: Mouse
Immunogen:: POMT2 (NP_037514, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: CVLGSSGKVLPKWGWEQLEVTCTPYLKETLNSIWNVEDHINPKLPNISLDVLQPSFPEILLESHMVMIRGNSGLKPKDNEFTSKPWHWPINYQGLRFS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket