SNX15 monoclonal antibody (M01), clone 1D4

Product Sizes

100 ug

£333.00

H00029907-M01-100UG

About this Product

SKU:: H00029907-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1D4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SNX15.
Host:: Mouse
Immunogen:: SNX15 (NP_037438, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG3, kappa
Reactivities:: Human
Sequence:: RYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGGEVTRPLEVSRDLH
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket