KLF15 monoclonal antibody (M02), clone 1F3

Product Sizes

100 ug

£333.00

H00028999-M02-100UG

About this Product

SKU:: H00028999-M02
Application:: ELISA, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 1F3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant KLF15.
Host:: Mouse
Immunogen:: KLF15 (NP_054798.1, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILD
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket