FLVCR monoclonal antibody (M05), clone 4B2

Product Sizes

100 ug

£333.00

H00028982-M05-100UG

About this Product

SKU:: H00028982-M05
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4B2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant FLVCR.
Host:: Mouse
Immunogen:: FLVCR (NP_054772, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2b, kappa
Reactivities:: Human
Sequence:: MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEEETQARLLP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket