SLC6A16 monoclonal antibody (M13), clone 2E5

Product Sizes

100 ug

£333.00

H00028968-M13-100UG

About this Product

SKU:: H00028968-M13
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 2E5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SLC6A16.
Host:: Mouse
Immunogen:: SLC6A16 (NP_054756.2, 406 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket