PPP2R3B monoclonal antibody (M14), clone 1F4
Product Sizes
100 ug
£333.00
H00028227-M14-100UG
About this Product
- SKU:
- H00028227-M14
- Application:
- ELISA, Immunoprecipitation, Western Blot
- translate.label.attr.clone:
- 1F4
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a full-length recombinant PPP2R3B.
- Host:
- Mouse
- Immunogen:
- PPP2R3B (AAH09032, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG1, kappa
- Reactivities:
- Human
- Sequence:
- MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLESL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00028227-M14
