ANGPTL3 monoclonal antibody (M10), clone 3F11

Product Sizes

100 ug

£333.00

H00027329-M10-100UG

About this Product

SKU:: H00027329-M10
Application:: ELISA, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 3F11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ANGPTL3.
Host:: Mouse
Immunogen:: ANGPTL3 (NP_055310.1, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: HLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket