PCDH11X monoclonal antibody (M05), clone 7B4

Product Sizes

50 ug

£333.00

H00027328-M05-50UG

About this Product

SKU:: H00027328-M05
Application:: ELISA, Western Blot
translate.label.attr.clone:: 7B4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant PCDH11X.
Host:: Mouse
Immunogen:: PCDH11X (NP_061850, 1228 a.a. ~ 1336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: AQASALCYSPPLAQAAAISHSSPLPQVIALHRSQAQSSVSLQQGWVQGADGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKVIPLTTFTPRQQARPSRGDSPIMEEHP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket